PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_015189-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 351aa    MW: 39889.3 Da    PI: 6.7345
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_015189-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.41.4e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd llv +++++G+g+W++++   g+ R+ k+c++rw +yl
  AHYPO_015189-RA 14 KGPWTPEEDILLVSYIQEHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding49.11.3e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  AHYPO_015189-RA  67 RGNFTDQEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.3E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.907965IPR017930Myb domain
SuperFamilySSF466893.18E-3011108IPR009057Homeodomain-like
SMARTSM007171.3E-141363IPR001005SANT/Myb domain
PfamPF002491.9E-161461IPR001005SANT/Myb domain
CDDcd001677.02E-111661No hitNo description
Gene3DG3DSA:1.10.10.607.0E-2565117IPR009057Homeodomain-like
SMARTSM007171.8E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129420.08666116IPR017930Myb domain
PfamPF002491.3E-1467112IPR001005SANT/Myb domain
CDDcd001672.23E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGRPPCCDKE GVKKGPWTPE EDILLVSYIQ EHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKNQ  120
SDHQNSRSEN GFISSPSSPE NYSSSSRGQW ERRLQTDIHM AKQALCDALS SMDEKPDSKL  180
PDLKKNNTQK TNLLVSNHTK QAQSNASSIY ASSTENIARL LQSWTKKSHK NQQSEGYNHT  240
KMMEIDYENE EKPKIVYEND QFSNNEEAFH SLFGTMDTSD QSPYSDFSQG VSPETSFFEQ  300
ESKPLADGGR GSLSVLEKWL FDDCSMQHCG AQTHVQDLID MPLQEAADFV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C7e-251411658159MYB PROTO-ONCOGENE PROTEIN
1h89_C7e-251411658159MYB PROTO-ONCOGENE PROTEIN
1h8a_C3e-251411627128MYB TRANSFORMING PROTEIN
1mse_C2e-25141164105C-Myb DNA-Binding Domain
1msf_C2e-25141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010693237.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-112MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0K9R2Y10.0A0A0K9R2Y1_SPIOL; Uncharacterized protein
STRINGPOPTR_0004s12530.11e-117(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-108myb domain protein 30